Recombinant Human BMP2 protein, His-tagged
| Cat.No. : | BMP2-6744H |
| Product Overview : | Recombinant Human BMP2 protein(27-102 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | His |
| Protein Length : | 27-102 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | ELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERA |
| Gene Name | BMP2 bone morphogenetic protein 2 [ Homo sapiens ] |
| Official Symbol | BMP2 |
| Synonyms | BMP2; bone morphogenetic protein 2; BMP2A; BMP-2A; bone morphogenetic protein 2A; BDA2; |
| Gene ID | 650 |
| mRNA Refseq | NM_001200 |
| Protein Refseq | NP_001191 |
| MIM | 112261 |
| UniProt ID | P12643 |
| ◆ Recombinant Proteins | ||
| BMP2-31084TH | Recombinant Human BMP2 | +Inquiry |
| BMP2-566R | Recombinant Rabbit BMP2 protein, His-tagged | +Inquiry |
| BMP2-17H | Active Recombinant Human BMP2 | +Inquiry |
| BMP2-05H | Active Recombinant Human/Mouse/Rat BMP2 Protein | +Inquiry |
| BMP2-261H | Recombinant Human BMP2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2 Products
Required fields are marked with *
My Review for All BMP2 Products
Required fields are marked with *
