Recombinant Human BMP3 Protein (363-472 aa), His-Myc-tagged

• Cat.No.: BMP3-2545H
• Product Overview: Recombinant Human BMP3 Protein (363-472 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Developmental Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His&Myc
• Protein Length: 363-472 aa
• Description: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.4 kDa
• AA Sequence: QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BMP3 bone morphogenetic protein 3 [ Homo sapiens ]
• Official Symbol: BMP3
• Synonyms: BMP3; bone morphogenetic protein 3; osteogenin; BMP-3; bone morphogenetic protein-3; BMP-3A
• Gene ID: 651
• mRNA Refseq: NM_001201
• Protein Refseq: NP_001192
• MIM: 112263
• UniProt ID: P12645