Recombinant Human BOC Protein, GST-tagged
Cat.No. : | BOC-297H |
Product Overview : | Human BOC full-length ORF ( AAH34614, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDON (MIM 608707) and BOC are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.01 kDa |
AA Sequence : | MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYS |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOC Boc homolog (mouse) [ Homo sapiens ] |
Official Symbol | BOC |
Synonyms | BOC |
Gene ID | 91653 |
mRNA Refseq | NM_033254.2 |
Protein Refseq | NP_150279.1 |
MIM | 608708 |
UniProt ID | Q9BWV1 |
◆ Recombinant Proteins | ||
BOC-296H | Recombinant Human BOC Protein | +Inquiry |
BOC-3761HF | Recombinant Full Length Human BOC Protein | +Inquiry |
BOC-790H | Active Recombinant Human BOC Protein, His-tagged | +Inquiry |
BOC-297H | Recombinant Human BOC Protein, GST-tagged | +Inquiry |
Boc-1825M | Recombinant Mouse Boc protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOC Products
Required fields are marked with *
My Review for All BOC Products
Required fields are marked with *
0
Inquiry Basket