Recombinant Human BOD1 Protein, GST-tagged
Cat.No. : | BOD1-3762H |
Product Overview : | Human FAM44B full-length ORF ( NP_612378.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BOD1 (Biorientation Of Chromosomes In Cell Division 1) is a Protein Coding gene. Diseases associated with BOD1 include Myoma. An important paralog of this gene is BOD1L2. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOD1 biorientation of chromosomes in cell division 1 [ Homo sapiens (human) ] |
Official Symbol | BOD1 |
Synonyms | BOD1; biorientation of chromosomes in cell division 1; Biorientation Of Chromosomes In Cell Division 1; Family With Sequence Similarity 44, Member B; Biorientation Defective 1; FAM44B; Biorientation Of Chromosomes In Cell Division Protein 1; Biorientation Defective Protein 1; Protein FAM44B; biorientation of chromosomes in cell division protein 1; biorientation defective 1; family with sequence similarity 44, member B |
Gene ID | 91272 |
mRNA Refseq | NM_001159651 |
Protein Refseq | NP_001153123 |
MIM | 616745 |
UniProt ID | Q96IK1 |
◆ Recombinant Proteins | ||
BOD1-4600HF | Recombinant Full Length Human BOD1 Protein, GST-tagged | +Inquiry |
BOD1-4555Z | Recombinant Zebrafish BOD1 | +Inquiry |
BOD1-3762H | Recombinant Human BOD1 Protein, GST-tagged | +Inquiry |
BOD1-1001R | Recombinant Rat BOD1 Protein | +Inquiry |
BOD1-659R | Recombinant Rat BOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOD1 Products
Required fields are marked with *
My Review for All BOD1 Products
Required fields are marked with *
0
Inquiry Basket