Recombinant Human BOK
| Cat.No. : | BOK-27663TH | 
| Product Overview : | Recombinant full length Human Bok with N terminal proprietary tag; Predicted MW 50.30 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 212 amino acids | 
| Description : | The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. | 
| Molecular Weight : | 50.300kDa inclusive of tags | 
| Tissue specificity : | Expressed in brain, liver, appendix and lymphoid tissues. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVH ARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF LKAAFFVLLPER | 
| Sequence Similarities : | Belongs to the Bcl-2 family. | 
| Gene Name | BOK BCL2-related ovarian killer [ Homo sapiens ] | 
| Official Symbol | BOK | 
| Synonyms | BOK; BCL2-related ovarian killer; bcl-2-related ovarian killer protein; BCL2L9; BOKL; MGC4631; | 
| Gene ID | 666 | 
| mRNA Refseq | NM_032515 | 
| Protein Refseq | NP_115904 | 
| MIM | 605404 | 
| Uniprot ID | Q9UMX3 | 
| Chromosome Location | 2q37.3 | 
| Pathway | Apoptosis, organism-specific biosystem; TP53 network, organism-specific biosystem; | 
| Function | BH domain binding; protein binding; protein heterodimerization activity; | 
| ◆ Recombinant Proteins | ||
| BOK-551R | Recombinant Rhesus monkey BOK Protein, His-tagged | +Inquiry | 
| BOK-379R | Recombinant Rhesus Macaque BOK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BOK-660R | Recombinant Rat BOK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BOK-6271C | Recombinant Chicken BOK | +Inquiry | 
| BOK-1065M | Recombinant Mouse BOK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BOK-8420HCL | Recombinant Human BOK 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOK Products
Required fields are marked with *
My Review for All BOK Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            