Recombinant Human BOK

Cat.No. : BOK-27663TH
Product Overview : Recombinant full length Human Bok with N terminal proprietary tag; Predicted MW 50.30 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 212 amino acids
Description : The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family.
Molecular Weight : 50.300kDa inclusive of tags
Tissue specificity : Expressed in brain, liver, appendix and lymphoid tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVH ARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF LKAAFFVLLPER
Sequence Similarities : Belongs to the Bcl-2 family.
Gene Name BOK BCL2-related ovarian killer [ Homo sapiens ]
Official Symbol BOK
Synonyms BOK; BCL2-related ovarian killer; bcl-2-related ovarian killer protein; BCL2L9; BOKL; MGC4631;
Gene ID 666
mRNA Refseq NM_032515
Protein Refseq NP_115904
MIM 605404
Uniprot ID Q9UMX3
Chromosome Location 2q37.3
Pathway Apoptosis, organism-specific biosystem; TP53 network, organism-specific biosystem;
Function BH domain binding; protein binding; protein heterodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BOK Products

Required fields are marked with *

My Review for All BOK Products

Required fields are marked with *

0
cart-icon