Recombinant Human BOK Protein, GST-tagged
Cat.No. : | BOK-299H |
Product Overview : | Human BOK partial ORF ( AAH17214, 95 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains all four BCL-2 like domains (BH1, 2, 3 and 4) and is a pro-apoptotic BCL-2 protein identified in the ovary. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.61 kDa |
AA Sequence : | SLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOK BCL2-related ovarian killer [ Homo sapiens ] |
Official Symbol | BOK |
Synonyms | BOK; BCL2-related ovarian killer; bcl-2-related ovarian killer protein; BCL2L9; BOKL; MGC4631; hBOK; bcl2-L-9; bcl-2-like protein 9; |
Gene ID | 666 |
mRNA Refseq | NM_032515 |
Protein Refseq | NP_115904 |
MIM | 605404 |
UniProt ID | Q9UMX3 |
◆ Recombinant Proteins | ||
BOK-40HF | Recombinant Full Length Human BOK Protein | +Inquiry |
BOK-2452M | Recombinant Mouse BOK Protein | +Inquiry |
BOK-379R | Recombinant Rhesus Macaque BOK Protein, His (Fc)-Avi-tagged | +Inquiry |
BOK-6271C | Recombinant Chicken BOK | +Inquiry |
BOK-27663TH | Recombinant Human BOK | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOK-8420HCL | Recombinant Human BOK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOK Products
Required fields are marked with *
My Review for All BOK Products
Required fields are marked with *
0
Inquiry Basket