Recombinant Human BOK Protein, GST-tagged

• Cat.No.: BOK-299H
• Product Overview: Human BOK partial ORF ( AAH17214, 95 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains all four BCL-2 like domains (BH1, 2, 3 and 4) and is a pro-apoptotic BCL-2 protein identified in the ovary.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.61 kDa
• AA Sequence: SLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BOK BCL2-related ovarian killer [ Homo sapiens ]
• Official Symbol: BOK
• Synonyms: BOK; BCL2-related ovarian killer; bcl-2-related ovarian killer protein; BCL2L9; BOKL; MGC4631; hBOK; bcl2-L-9; bcl-2-like protein 9
• Gene ID: 666
• mRNA Refseq: NM_032515
• Protein Refseq: NP_115904
• MIM: 605404
• UniProt ID: Q9UMX3