Recombinant Human BORCS8 Protein, GST-tagged
| Cat.No. : | BORCS8-4457H |
| Product Overview : | Human MEF2BNB full-length ORF (AAH04449.1, 1 a.a. - 109 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | BORCS8 (BLOC-1 Related Complex Subunit 8) is a Protein Coding gene. Among its related pathways are P38 MAPK Signaling Pathway (sino). |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BORCS8 BLOC-1 related complex subunit 8 [ Homo sapiens (human) ] |
| Official Symbol | BORCS8 |
| Synonyms | MEF2BNB; MEF2B neighbor; protein MEF2BNB; MEF2B neighbor gene protein; AK128256; FLJ32599; FLJ46391; MGC189732; MGC189763; BORCS8; BLOC-1 related complex subunit 8 |
| Gene ID | 729991 |
| mRNA Refseq | NM_001145783 |
| Protein Refseq | NP_001139255 |
| UniProt ID | Q96FH0 |
| ◆ Recombinant Proteins | ||
| Borcs8-1884M | Recombinant Mouse Borcs8 Protein, Myc/DDK-tagged | +Inquiry |
| BORCS8-4457H | Recombinant Human BORCS8 Protein, GST-tagged | +Inquiry |
| BORCS8-6259HF | Recombinant Full Length Human BORCS8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BORCS8 Products
Required fields are marked with *
My Review for All BORCS8 Products
Required fields are marked with *



