Recombinant Human BPIFA2 protein, His-tagged
| Cat.No. : | BPIFA2-3134H |
| Product Overview : | Recombinant Human BPIFA2 protein(15-123 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 15-123 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | TGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ] |
| Official Symbol | BPIFA2 |
| Synonyms | BPIFA2; BPI fold containing family A, member 2; C20orf70, chromosome 20 open reading frame 70; BPI fold-containing family A member 2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; short palate, lung and nasal epithelium carcinoma associated 2; short palate, lung and nasal epithelium carcinoma-associated protein 2; C20orf70; |
| Gene ID | 140683 |
| mRNA Refseq | NM_080574 |
| Protein Refseq | NP_542141 |
| UniProt ID | Q96DR5 |
| ◆ Recombinant Proteins | ||
| BPIFA2-5805H | Recombinant Human BPIFA2 protein, His-sumostar-tagged | +Inquiry |
| BPIFA2-1007R | Recombinant Rat BPIFA2 Protein | +Inquiry |
| BPIFA2-7381H | Recombinant Human BPIFA2 protein(Met1-Ile249), hFc-tagged | +Inquiry |
| BPIFA2-2254H | Recombinant Human BPIFA2 Protein (14-249 aa), His-SUMOSTAR-tagged | +Inquiry |
| BPIFA2-2143H | Recombinant Human BPIFA2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BPIFA2-1338HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
| BPIFA2-1459HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFA2 Products
Required fields are marked with *
My Review for All BPIFA2 Products
Required fields are marked with *
