Recombinant Human BPNT1, His-tagged
| Cat.No. : | BPNT1-27671TH |
| Product Overview : | Recombinant full length Human BPNT1 with an N terminal His tag; 344 amino acids with a predicted MWt 37.5 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 308 amino acids |
| Description : | BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntases physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. |
| Conjugation : | HIS |
| Molecular Weight : | 37.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP |
| Gene Name | BPNT1 3(2), 5-bisphosphate nucleotidase 1 [ Homo sapiens ] |
| Official Symbol | BPNT1 |
| Synonyms | BPNT1; 3(2), 5-bisphosphate nucleotidase 1; 3(2),5-bisphosphate nucleotidase 1; |
| Gene ID | 10380 |
| mRNA Refseq | NM_006085 |
| Protein Refseq | NP_006076 |
| MIM | 604053 |
| Uniprot ID | O95861 |
| Chromosome Location | 1q42 |
| Pathway | Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; |
| Function | 3(2),5-bisphosphate nucleotidase activity; hydrolase activity; magnesium ion binding; |
| ◆ Recombinant Proteins | ||
| Bpnt1-1077M | Recombinant Mouse Bpnt1 protein, His & T7-tagged | +Inquiry |
| BPNT1-2092C | Recombinant Chicken BPNT1 | +Inquiry |
| BPNT1-10277H | Recombinant Human BPNT1, GST-tagged | +Inquiry |
| BPNT1-1009R | Recombinant Rat BPNT1 Protein | +Inquiry |
| BPNT1-501Z | Recombinant Zebrafish BPNT1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BPNT1-8415HCL | Recombinant Human BPNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPNT1 Products
Required fields are marked with *
My Review for All BPNT1 Products
Required fields are marked with *
