Recombinant Human BPNT1, His-tagged

Cat.No. : BPNT1-27671TH
Product Overview : Recombinant full length Human BPNT1 with an N terminal His tag; 344 amino acids with a predicted MWt 37.5 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 308 amino acids
Description : BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntases physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
Conjugation : HIS
Molecular Weight : 37.500kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP
Gene Name BPNT1 3(2), 5-bisphosphate nucleotidase 1 [ Homo sapiens ]
Official Symbol BPNT1
Synonyms BPNT1; 3(2), 5-bisphosphate nucleotidase 1; 3(2),5-bisphosphate nucleotidase 1;
Gene ID 10380
mRNA Refseq NM_006085
Protein Refseq NP_006076
MIM 604053
Uniprot ID O95861
Chromosome Location 1q42
Pathway Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem;
Function 3(2),5-bisphosphate nucleotidase activity; hydrolase activity; magnesium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPNT1 Products

Required fields are marked with *

My Review for All BPNT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon