Recombinant Human BPNT1 Protein, GST-tagged
Cat.No. : | BPNT1-315H |
Product Overview : | Human BPNT1 full-length ORF ( NP_006076.3, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntases physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGAS |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BPNT1 3(2), 5-bisphosphate nucleotidase 1 [ Homo sapiens ] |
Official Symbol | BPNT1 |
Synonyms | BPNT1; 3(2), 5-bisphosphate nucleotidase 1; 3(2),5-bisphosphate nucleotidase 1; BPntase; PAP-inositol-1,4-phosphatase; bisphosphate 3-nucleotidase 1; PIP; |
Gene ID | 10380 |
mRNA Refseq | NM_006085 |
Protein Refseq | NP_006076 |
MIM | 604053 |
UniProt ID | O95861 |
◆ Recombinant Proteins | ||
BPNT1-3773HF | Recombinant Full Length Human BPNT1 Protein, GST-tagged | +Inquiry |
Bpnt1-1889M | Recombinant Mouse Bpnt1 Protein, Myc/DDK-tagged | +Inquiry |
BPNT1-667R | Recombinant Rat BPNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BPNT1-1009R | Recombinant Rat BPNT1 Protein | +Inquiry |
BPNT1-2092C | Recombinant Chicken BPNT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPNT1-8415HCL | Recombinant Human BPNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPNT1 Products
Required fields are marked with *
My Review for All BPNT1 Products
Required fields are marked with *