Recombinant Human BRCC3 Protein, GST-tagged
Cat.No. : | BRCC3-328H |
Product Overview : | Human BRCC3 full-length ORF ( NP_077308.1, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the BRCA1-BRCA2-containing complex (BRCC), which is an E3 ubiquitin ligase. This protein is also thought to be involved in the cellular response to ionizing radiation and progression through the G2/M checkpoint. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 62.5 kDa |
AA Sequence : | MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRCC3 BRCA1/BRCA2-containing complex, subunit 3 [ Homo sapiens ] |
Official Symbol | BRCC3 |
Synonyms | BRCC3; BRCA1/BRCA2-containing complex, subunit 3; chromosome X open reading frame 53 , CXorf53; lys-63-specific deubiquitinase BRCC36; BRCC36; C6.1A; BRISC complex subunit BRCC36; BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; CXorf53; RP11-143H17.2; |
Gene ID | 79184 |
mRNA Refseq | NM_001018055 |
Protein Refseq | NP_001018065 |
MIM | 300617 |
UniProt ID | P46736 |
◆ Recombinant Proteins | ||
BRCC3-3783HF | Recombinant Full Length Human BRCC3 Protein, GST-tagged | +Inquiry |
BRCC3-0681H | Recombinant Human BRCC3 Protein (M1-E316), Tag Free | +Inquiry |
BRCC3-10280H | Recombinant Human BRCC3, His-tagged | +Inquiry |
BRCC3-1085M | Recombinant Mouse BRCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRCC3-669R | Recombinant Rat BRCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRCC3-8412HCL | Recombinant Human BRCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRCC3 Products
Required fields are marked with *
My Review for All BRCC3 Products
Required fields are marked with *
0
Inquiry Basket