Recombinant Human BRCC3 protein, His-GST-tagged
Cat.No. : | BRCC3-2603H |
Product Overview : | Recombinant Human BRCC3 protein(P46736)(2-316aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 2-316aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 65.9 kDa |
AA Sequence : | AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BRCC3 BRCA1/BRCA2-containing complex, subunit 3 [ Homo sapiens ] |
Official Symbol | BRCC3 |
Synonyms | BRCC3; BRCA1/BRCA2-containing complex, subunit 3; chromosome X open reading frame 53 , CXorf53; lys-63-specific deubiquitinase BRCC36; BRCC36; C6.1A; BRISC complex subunit BRCC36; BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; CXorf53; RP11-143H17.2; |
Gene ID | 79184 |
mRNA Refseq | NM_001018055 |
Protein Refseq | NP_001018065 |
MIM | 300617 |
UniProt ID | P46736 |
◆ Recombinant Proteins | ||
BRCC3-2481M | Recombinant Mouse BRCC3 Protein | +Inquiry |
BRCC3-2603H | Recombinant Human BRCC3 protein, His-GST-tagged | +Inquiry |
BRCC3-669R | Recombinant Rat BRCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRCC3-10280H | Recombinant Human BRCC3, His-tagged | +Inquiry |
BRCC3-3783HF | Recombinant Full Length Human BRCC3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRCC3-8412HCL | Recombinant Human BRCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRCC3 Products
Required fields are marked with *
My Review for All BRCC3 Products
Required fields are marked with *