Recombinant Human BRCC3 Protein, His-SUMO-tagged

Cat.No. : BRCC3-1148H
Product Overview : Recombinant Human BRCC3 Protein (2-316aa) was expressed in E. coli with His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-316 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 51.9 kDa
AA Sequence : AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name BRCC3 BRCA1/BRCA2-containing complex, subunit 3 [ Homo sapiens ]
Official Symbol BRCC3
Synonyms BRCC3; BRCA1/BRCA2-containing complex, subunit 3; chromosome X open reading frame 53 , CXorf53; lys-63-specific deubiquitinase BRCC36; BRCC36; C6.1A; BRISC complex subunit BRCC36; BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; CXorf53; RP11-143H17.2
Gene ID 79184
mRNA Refseq NM_001018055
Protein Refseq NP_001018065
MIM 300617
UniProt ID P46736

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRCC3 Products

Required fields are marked with *

My Review for All BRCC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon