Recombinant Human BRCC3 Protein, His-SUMO-tagged
| Cat.No. : | BRCC3-1148H |
| Product Overview : | Recombinant Human BRCC3 Protein (2-316aa) was expressed in E. coli with His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-316 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | BRCC3 BRCA1/BRCA2-containing complex, subunit 3 [ Homo sapiens ] |
| Official Symbol | BRCC3 |
| Synonyms | BRCC3; BRCA1/BRCA2-containing complex, subunit 3; chromosome X open reading frame 53 , CXorf53; lys-63-specific deubiquitinase BRCC36; BRCC36; C6.1A; BRISC complex subunit BRCC36; BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; CXorf53; RP11-143H17.2 |
| Gene ID | 79184 |
| mRNA Refseq | NM_001018055 |
| Protein Refseq | NP_001018065 |
| MIM | 300617 |
| UniProt ID | P46736 |
| ◆ Recombinant Proteins | ||
| BRCC3-2603H | Recombinant Human BRCC3 protein, His-GST-tagged | +Inquiry |
| BRCC3-2481M | Recombinant Mouse BRCC3 Protein | +Inquiry |
| BRCC3-105H | Recombinant Human BRCC3 protein, His-tagged | +Inquiry |
| BRCC3-0681H | Recombinant Human BRCC3 Protein (M1-E316), Tag Free | +Inquiry |
| BRCC3-1148H | Recombinant Human BRCC3 Protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BRCC3-8412HCL | Recombinant Human BRCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRCC3 Products
Required fields are marked with *
My Review for All BRCC3 Products
Required fields are marked with *
