Recombinant Human BRD2

Cat.No. : BRD2-27674TH
Product Overview : Recombinant fragment of Human BRD2 (amino acids 167-256) with N terminal proprietary tag; Predicted MWt 35.53 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
Sequence Similarities : Contains 2 bromo domains.Contains 1 ET domain.
Gene Name BRD2 bromodomain containing 2 [ Homo sapiens ]
Official Symbol BRD2
Synonyms BRD2; bromodomain containing 2; bromodomain-containing protein 2; D6S113E; FSRG1; KIAA9001; NAT; RING3;
Gene ID 6046
mRNA Refseq NM_005104
Protein Refseq NP_005095
MIM 601540
Uniprot ID P25440
Chromosome Location 6p21.3
Pathway Regulation of retinoblastoma protein, organism-specific biosystem;
Function protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRD2 Products

Required fields are marked with *

My Review for All BRD2 Products

Required fields are marked with *

0
cart-icon