Recombinant Human BRD2
Cat.No. : | BRD2-27674TH |
Product Overview : | Recombinant fragment of Human BRD2 (amino acids 167-256) with N terminal proprietary tag; Predicted MWt 35.53 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS |
Sequence Similarities : | Contains 2 bromo domains.Contains 1 ET domain. |
Gene Name | BRD2 bromodomain containing 2 [ Homo sapiens ] |
Official Symbol | BRD2 |
Synonyms | BRD2; bromodomain containing 2; bromodomain-containing protein 2; D6S113E; FSRG1; KIAA9001; NAT; RING3; |
Gene ID | 6046 |
mRNA Refseq | NM_005104 |
Protein Refseq | NP_005095 |
MIM | 601540 |
Uniprot ID | P25440 |
Chromosome Location | 6p21.3 |
Pathway | Regulation of retinoblastoma protein, organism-specific biosystem; |
Function | protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
BRD2-3784HF | Recombinant Full Length Human BRD2 Protein, GST-tagged | +Inquiry |
BRD2-91H | Recombinant Human BRD2 protein, His-tagged | +Inquiry |
BRD2-4346H | Recombinant Human BRD2 protein, GST-tagged | +Inquiry |
BRD2-4345H | Recombinant Human BRD2 protein, His&FLAG-tagged | +Inquiry |
BRD2-4344H | Recombinant Human BRD2(BD1+BD2) protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD2-177HCL | Recombinant Human BRD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRD2 Products
Required fields are marked with *
My Review for All BRD2 Products
Required fields are marked with *