Recombinant Human BRD2 protein, IaN-His-tagged
Cat.No. : | BRD2-4700H |
Product Overview : | Recombinant Human BRD2 protein(P25440)(339-459 aa), fused with N-terminal IaN tag and C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 339-459 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 17.1 kDa |
AASequence : | QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | BRD2 bromodomain containing 2 [ Homo sapiens ] |
Official Symbol | BRD2 |
Synonyms | BRD2; bromodomain containing 2; bromodomain-containing protein 2; D6S113E; FSRG1; KIAA9001; NAT; RING3; O27.1.1; bromodomain-containing 2; really interesting new gene 3 protein; female sterile homeotic-related gene 1; FSH; RNF3; FLJ31942; DKFZp686N0336; |
Gene ID | 6046 |
mRNA Refseq | NM_001113182 |
Protein Refseq | NP_001106653 |
MIM | 601540 |
UniProt ID | P25440 |
◆ Recombinant Proteins | ||
BRD2-4348H | Recombinant Human BRD2 protein, GST-tagged | +Inquiry |
BRD2-2378C | Recombinant Chicken BRD2 | +Inquiry |
BRD2-4346H | Recombinant Human BRD2 protein, GST-tagged | +Inquiry |
BRD2-670R | Recombinant Rat BRD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRD2-653H | Recombinant Human bromodomain containing 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD2-177HCL | Recombinant Human BRD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRD2 Products
Required fields are marked with *
My Review for All BRD2 Products
Required fields are marked with *
0
Inquiry Basket