Recombinant Human BRD2 protein, IaN-His-tagged

• Cat.No.: BRD2-4700H
• Product Overview: Recombinant Human BRD2 protein(P25440)(339-459 aa), fused with N-terminal IaN tag and C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 339-459 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 17.1 kDa
• AASequence: QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: BRD2 bromodomain containing 2 [ Homo sapiens ]
• Official Symbol: BRD2
• Synonyms: BRD2; bromodomain containing 2; bromodomain-containing protein 2; D6S113E; FSRG1; KIAA9001; NAT; RING3; O27.1.1; bromodomain-containing 2; really interesting new gene 3 protein; female sterile homeotic-related gene 1; FSH; RNF3; FLJ31942; DKFZp686N0336
• Gene ID: 6046
• mRNA Refseq: NM_001113182
• Protein Refseq: NP_001106653
• MIM: 601540
• UniProt ID: P25440