Recombinant Human BRD2 protein, IaN-His-tagged

Cat.No. : BRD2-4700H
Product Overview : Recombinant Human BRD2 protein(P25440)(339-459 aa), fused with N-terminal IaN tag and C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 339-459 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 17.1 kDa
AASequence : QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name BRD2 bromodomain containing 2 [ Homo sapiens ]
Official Symbol BRD2
Synonyms BRD2; bromodomain containing 2; bromodomain-containing protein 2; D6S113E; FSRG1; KIAA9001; NAT; RING3; O27.1.1; bromodomain-containing 2; really interesting new gene 3 protein; female sterile homeotic-related gene 1; FSH; RNF3; FLJ31942; DKFZp686N0336;
Gene ID 6046
mRNA Refseq NM_001113182
Protein Refseq NP_001106653
MIM 601540
UniProt ID P25440

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRD2 Products

Required fields are marked with *

My Review for All BRD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon