Recombinant Human BRF2 Protein, GST-tagged
| Cat.No. : | BRF2-337H | 
| Product Overview : | Human BRF2 full-length ORF ( AAH10648, 1 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein. | 
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 71.83 kDa | 
| AA Sequence : | MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP | 
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | BRF2 BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like [ Homo sapiens ] | 
| Official Symbol | BRF2 | 
| Synonyms | BRF2; BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like; transcription factor IIIB 50 kDa subunit; BRFU; FLJ11052; TFIIIB50; BRF-2; hBRFU; hTFIIIB50; B-related factor 2; transcription factor IIB- related factor, TFIIIB50; RNA polymerase III transcription initiation factor BRFU; | 
| Gene ID | 55290 | 
| mRNA Refseq | NM_018310 | 
| Protein Refseq | NP_060780 | 
| MIM | 607013 | 
| UniProt ID | Q9HAW0 | 
| ◆ Recombinant Proteins | ||
| BRF2-672R | Recombinant Rat BRF2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BRF2-98C | Recombinant Cynomolgus Monkey BRF2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BRF2-1014R | Recombinant Rat BRF2 Protein | +Inquiry | 
| BRF2-10288H | Recombinant Human BRF2, GST-tagged | +Inquiry | 
| Brf2-1893M | Recombinant Mouse Brf2 Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BRF2-8408HCL | Recombinant Human BRF2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRF2 Products
Required fields are marked with *
My Review for All BRF2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            