Active Recombinant Human BRS3 Protein, GST-tagged
| Cat.No. : | BRS3-347H |
| Product Overview : | Human BRS3 partial ORF ( NP_001718, 290 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mammalian bombesin-like peptides (see MIM 137260) are widely distributed in the central nervous system as well as in the gastrointestinal tract, where they modulate smooth-muscle contraction, exocrine and endocrine processes, metabolism, and behavior. They bind to G protein-coupled receptors on the cell surface to elicit their effects. Bombesin-like peptide receptors include gastrin-releasing peptide receptor (MIM 305670), neuromedin B receptor (MIM 162341), and bombesin-like receptor-3 (BRS3) (Ohki-Hamazaki et al., 1997). |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Bio-activity : | The activity was measured by off-chip mobility shift assay. The enzyme was incubated with fluorescence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by LabChip 3000. Substrate: CHKtide. ATP: 100 uM. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | LYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BRS3 bombesin-like receptor 3 [ Homo sapiens ] |
| Official Symbol | BRS3 |
| Synonyms | BRS3; bombesin-like receptor 3; bombesin receptor subtype-3; BRS-3; G-protein coupled receptor; bombesin receptor subtype 3; |
| Gene ID | 680 |
| mRNA Refseq | NM_001727 |
| Protein Refseq | NP_001718 |
| MIM | 300107 |
| UniProt ID | P32247 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRS3 Products
Required fields are marked with *
My Review for All BRS3 Products
Required fields are marked with *
