Recombinant Human BRWD1 Protein, GST-tagged
| Cat.No. : | BRWD1-355H |
| Product Overview : | Human BRWD1 full-length ORF ( NP_001007247.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3 ends. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 40 kDa |
| AA Sequence : | MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BRWD1 bromodomain and WD repeat domain containing 1 [ Homo sapiens ] |
| Official Symbol | BRWD1 |
| Synonyms | BRWD1; bromodomain and WD repeat domain containing 1; C21orf107, chromosome 21 open reading frame 107 , WD repeat domain 9 , WDR9; bromodomain and WD repeat-containing protein 1; FLJ11315; N143; transcriptional unit N143; WD repeat protein WDR9-form2; WD repeat-containing protein 9; WDR9; C21orf107; FLJ43918; |
| Gene ID | 54014 |
| mRNA Refseq | NM_001007246 |
| Protein Refseq | NP_001007247 |
| UniProt ID | Q9NSI6 |
| ◆ Recombinant Proteins | ||
| BRWD1-3823HF | Recombinant Full Length Human BRWD1 Protein, GST-tagged | +Inquiry |
| BRWD1-62H | Recombinant Human BRWD1 protein, GST-tagged | +Inquiry |
| BRWD1-167H | Recombinant Human BRWD1, GST-tagged | +Inquiry |
| BRWD1-38H | Recombinant Human BRWD1, His&FLAG-tagged | +Inquiry |
| BRWD1-4654H | Recombinant Human BRWD1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BRWD1-186HCL | Recombinant Human BRWD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRWD1 Products
Required fields are marked with *
My Review for All BRWD1 Products
Required fields are marked with *
