Recombinant Full Length Human BRWD1 Protein, GST-tagged

Cat.No. : BRWD1-3823HF
Product Overview : Human BRWD1 full-length ORF ( NP_001007247.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 120 amino acids
Description : This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3 ends.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 40 kDa
AA Sequence : MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRWD1 bromodomain and WD repeat domain containing 1 [ Homo sapiens ]
Official Symbol BRWD1
Synonyms BRWD1; bromodomain and WD repeat domain containing 1; C21orf107, chromosome 21 open reading frame 107 , WD repeat domain 9 , WDR9; bromodomain and WD repeat-containing protein 1; FLJ11315; N143; transcriptional unit N143; WD repeat protein WDR9-form2; WD repeat-containing protein 9; WDR9; C21orf107; FLJ43918;
Gene ID 54014
mRNA Refseq NM_001007246
Protein Refseq NP_001007247
MIM 617824
UniProt ID Q9NSI6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRWD1 Products

Required fields are marked with *

My Review for All BRWD1 Products

Required fields are marked with *

0
cart-icon