Recombinant Human BRWD1 protein, His-tagged
Cat.No. : | BRWD1-4654H |
Product Overview : | Recombinant Human BRWD1 protein(1-120 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-120 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BRWD1 bromodomain and WD repeat domain containing 1 [ Homo sapiens ] |
Official Symbol | BRWD1 |
Synonyms | BRWD1; bromodomain and WD repeat domain containing 1; C21orf107, chromosome 21 open reading frame 107 , WD repeat domain 9 , WDR9; bromodomain and WD repeat-containing protein 1; FLJ11315; N143; transcriptional unit N143; WD repeat protein WDR9-form2; WD repeat-containing protein 9; WDR9; C21orf107; FLJ43918; |
Gene ID | 54014 |
mRNA Refseq | NM_001007246 |
Protein Refseq | NP_001007247 |
UniProt ID | Q9NSI6 |
◆ Recombinant Proteins | ||
BRWD1-63H | Recombinant Human BRWD1 protein, His-tagged | +Inquiry |
BRWD1-38H | Recombinant Human BRWD1, His&FLAG-tagged | +Inquiry |
BRWD1-62H | Recombinant Human BRWD1 protein, GST-tagged | +Inquiry |
BRWD1-4654H | Recombinant Human BRWD1 protein, His-tagged | +Inquiry |
BRWD1-3823HF | Recombinant Full Length Human BRWD1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRWD1-186HCL | Recombinant Human BRWD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRWD1 Products
Required fields are marked with *
My Review for All BRWD1 Products
Required fields are marked with *