Recombinant Human BSG protein, His/Myc-tagged

Cat.No. : BSG-205H
Product Overview : Recombinant Human BSG protein(138-323aa) was fused to His/Myc-tagged at C-terminus and expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&Myc
Protein Length : Partial
Description : The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.9 kDa
AA Sequence : EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name BSG
Official Symbol BSG
Synonyms 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor
Gene ID 682
MIM 109480
UniProt ID P35613

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BSG Products

Required fields are marked with *

My Review for All BSG Products

Required fields are marked with *

0
cart-icon