Recombinant Human BSG protein, His/Myc-tagged
Cat.No. : | BSG-205H |
Product Overview : | Recombinant Human BSG protein(138-323aa) was fused to His/Myc-tagged at C-terminus and expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&Myc |
Protein Length : | Partial |
Description : | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.9 kDa |
AA Sequence : | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BSG |
Official Symbol | BSG |
Synonyms | 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor |
Gene ID | 682 |
MIM | 109480 |
UniProt ID | P35613 |
◆ Recombinant Proteins | ||
BSG-1577R | Recombinant Rhesus Monkey BSG Protein, hIgG1-tagged | +Inquiry |
BSG-271H | Recombinant Human BSG Protein, DYKDDDDK-tagged | +Inquiry |
BSG-1576R | Recombinant Rhesus Monkey BSG Protein | +Inquiry |
BSG-3874H | Recombinant Human BSG Protein(138-321aa), His-tagged | +Inquiry |
BSG-4233C | Recombinant Chicken BSG | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *