Recombinant Human BSG, GST-tagged
Cat.No. : | BSG-105H |
Product Overview : | Human BSG full-length ORF ( 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFK VDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINE GETAMLVCKSESVPPVTDWAWYKITDSEDKA LMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVT IIFIYEKRRKPE DVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BSG basigin (Ok blood group) [ Homo sapiens (human) ] |
Official Symbol | BSG |
Synonyms | BSG; M6; OK; 5F7; TCSF; CD147; EMMPRIN; basigin (Ok blood group); basigin; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor |
Gene ID | 682 |
mRNA Refseq | NM_198589 |
Protein Refseq | NP_940991 |
MIM | 109480 |
UniProt ID | P35613 |
Chromosome Location | 19p13.3 |
Pathway | Basigin interactions; Cell surface interactions at the vascular wall; Integrin cell surface interactions |
Function | mannose binding; protein binding |
◆ Recombinant Proteins | ||
BSG-152H | Recombinant Human BSG Protein, DYKDDDDK-tagged | +Inquiry |
BSG-1414H | Active Recombinant Human BSG protein, Fc-tagged | +Inquiry |
BSG-1578R | Recombinant Rhesus Monkey BSG Protein, hIgG4-tagged | +Inquiry |
BSG-05H | Recombinant Human BSG Protein, Fc-tagged | +Inquiry |
BSG-9798Z | Recombinant Zebrafish BSG | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *