Recombinant Human BSG, GST-tagged

Cat.No. : BSG-105H
Product Overview : Human BSG full-length ORF ( 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 55.6 kDa
AA Sequence : MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFK VDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINE GETAMLVCKSESVPPVTDWAWYKITDSEDKA LMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVT IIFIYEKRRKPE DVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BSG basigin (Ok blood group) [ Homo sapiens (human) ]
Official Symbol BSG
Synonyms BSG; M6; OK; 5F7; TCSF; CD147; EMMPRIN; basigin (Ok blood group); basigin; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor
Gene ID 682
mRNA Refseq NM_198589
Protein Refseq NP_940991
MIM 109480
UniProt ID P35613
Chromosome Location 19p13.3
Pathway Basigin interactions; Cell surface interactions at the vascular wall; Integrin cell surface interactions
Function mannose binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BSG Products

Required fields are marked with *

My Review for All BSG Products

Required fields are marked with *

0
cart-icon