Recombinant Human BSN protein, His-tagged

• Cat.No.: BSN-23H
• Product Overview: Recombinant Human SV2A protein(Q7L0J3)(Phe11-Gly160), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Phe11-Gly160
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 20 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: FIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECG

Gene Information

• Gene Name: SV2A synaptic vesicle glycoprotein 2A [ Homo sapiens ]
• Official Symbol: SV2A
• Synonyms: SV2A; synaptic vesicle glycoprotein 2A; KIAA0736; SV2
• Gene ID: 9900
• mRNA Refseq: NM_014849
• Protein Refseq: NP_055664
• MIM: 185860
• UniProt ID: Q7L0J3