Recombinant Human BSN protein, His-tagged

Cat.No. : BSN-23H
Product Overview : Recombinant Human SV2A protein(Q7L0J3)(Phe11-Gly160), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Phe11-Gly160
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 20 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : FIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECG
Gene Name SV2A synaptic vesicle glycoprotein 2A [ Homo sapiens ]
Official Symbol SV2A
Synonyms SV2A; synaptic vesicle glycoprotein 2A; KIAA0736; SV2;
Gene ID 9900
mRNA Refseq NM_014849
Protein Refseq NP_055664
MIM 185860
UniProt ID Q7L0J3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BSN Products

Required fields are marked with *

My Review for All BSN Products

Required fields are marked with *

0
cart-icon