Recombinant Human BSN protein, His-tagged
Cat.No. : | BSN-23H |
Product Overview : | Recombinant Human SV2A protein(Q7L0J3)(Phe11-Gly160), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Phe11-Gly160 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 20 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECG |
Gene Name | SV2A synaptic vesicle glycoprotein 2A [ Homo sapiens ] |
Official Symbol | SV2A |
Synonyms | SV2A; synaptic vesicle glycoprotein 2A; KIAA0736; SV2; |
Gene ID | 9900 |
mRNA Refseq | NM_014849 |
Protein Refseq | NP_055664 |
MIM | 185860 |
UniProt ID | Q7L0J3 |
◆ Recombinant Proteins | ||
BSN-1098M | Recombinant Mouse BSN Protein, His (Fc)-Avi-tagged | +Inquiry |
Bsn-329M | Recombinant Mouse Bsn Protein, His-tagged | +Inquiry |
BSN-301502H | Recombinant Human BSN protein, GST-tagged | +Inquiry |
BSN-675H | Recombinant Human BSN | +Inquiry |
BSN-2779B | Recombinant Bacillus subtilis BSN protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSN Products
Required fields are marked with *
My Review for All BSN Products
Required fields are marked with *