Recombinant Human BSN protein, His-tagged
| Cat.No. : | BSN-23H |
| Product Overview : | Recombinant Human SV2A protein(Q7L0J3)(Phe11-Gly160), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Phe11-Gly160 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 20 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | FIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECG |
| Gene Name | SV2A synaptic vesicle glycoprotein 2A [ Homo sapiens ] |
| Official Symbol | SV2A |
| Synonyms | SV2A; synaptic vesicle glycoprotein 2A; KIAA0736; SV2; |
| Gene ID | 9900 |
| mRNA Refseq | NM_014849 |
| Protein Refseq | NP_055664 |
| MIM | 185860 |
| UniProt ID | Q7L0J3 |
| ◆ Recombinant Proteins | ||
| BSN-1098M | Recombinant Mouse BSN Protein, His (Fc)-Avi-tagged | +Inquiry |
| BSN-2562H | Recombinant Human BSN Protein, His (Fc)-Avi-tagged | +Inquiry |
| BSN-2508M | Recombinant Mouse BSN Protein | +Inquiry |
| BSN-23H | Recombinant Human BSN protein, His-tagged | +Inquiry |
| BSN-675H | Recombinant Human BSN | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSN Products
Required fields are marked with *
My Review for All BSN Products
Required fields are marked with *
