Recombinant Human BSPRY Protein, GST-tagged
Cat.No. : | BSPRY-362H |
Product Overview : | Human BSPRY full-length ORF ( AAH01477.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BSPRY B-box and SPRY domain containing [ Homo sapiens ] |
Official Symbol | BSPRY |
Synonyms | BSPRY; B-box and SPRY domain containing; B box and SPRY domain-containing protein; FLJ20150; zetin 1; B-box and SPRY-domain containing protein; |
Gene ID | 54836 |
mRNA Refseq | NM_017688 |
Protein Refseq | NP_060158 |
UniProt ID | Q5W0U4 |
◆ Recombinant Proteins | ||
BSPRY-2837H | Recombinant Human BSPRY Protein, MYC/DDK-tagged | +Inquiry |
BSPRY-3744HF | Recombinant Full Length Human BSPRY Protein, GST-tagged | +Inquiry |
BSPRY-6632H | Recombinant Human BSPRY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BSPRY-2673H | Recombinant Human BSPRY protein, His-tagged | +Inquiry |
Bspry-1896M | Recombinant Mouse Bspry Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSPRY-187HCL | Recombinant Human BSPRY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BSPRY Products
Required fields are marked with *
My Review for All BSPRY Products
Required fields are marked with *
0
Inquiry Basket