Recombinant Human BSPRY Protein, GST-tagged
| Cat.No. : | BSPRY-362H |
| Product Overview : | Human BSPRY full-length ORF ( AAH01477.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BSPRY B-box and SPRY domain containing [ Homo sapiens ] |
| Official Symbol | BSPRY |
| Synonyms | BSPRY; B-box and SPRY domain containing; B box and SPRY domain-containing protein; FLJ20150; zetin 1; B-box and SPRY-domain containing protein; |
| Gene ID | 54836 |
| mRNA Refseq | NM_017688 |
| Protein Refseq | NP_060158 |
| UniProt ID | Q5W0U4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSPRY Products
Required fields are marked with *
My Review for All BSPRY Products
Required fields are marked with *



