Recombinant Human BSPRY protein, His-tagged
| Cat.No. : | BSPRY-2673H |
| Product Overview : | Recombinant Human BSPRY protein(1-193 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | June 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-193 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BSPRY B-box and SPRY domain containing [ Homo sapiens ] |
| Official Symbol | BSPRY |
| Synonyms | BSPRY; B-box and SPRY domain containing; B box and SPRY domain-containing protein; FLJ20150; zetin 1; B-box and SPRY-domain containing protein; |
| Gene ID | 54836 |
| mRNA Refseq | NM_017688 |
| Protein Refseq | NP_060158 |
| UniProt ID | Q5W0U4 |
| ◆ Recombinant Proteins | ||
| BSPRY-6632H | Recombinant Human BSPRY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BSPRY-2837H | Recombinant Human BSPRY Protein, MYC/DDK-tagged | +Inquiry |
| Bspry-1896M | Recombinant Mouse Bspry Protein, Myc/DDK-tagged | +Inquiry |
| BSPRY-362H | Recombinant Human BSPRY Protein, GST-tagged | +Inquiry |
| BSPRY-3744HF | Recombinant Full Length Human BSPRY Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BSPRY-187HCL | Recombinant Human BSPRY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSPRY Products
Required fields are marked with *
My Review for All BSPRY Products
Required fields are marked with *
