Recombinant Human BSPRY protein, His-tagged
Cat.No. : | BSPRY-2673H |
Product Overview : | Recombinant Human BSPRY protein(1-193 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-193 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AASequence : | MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BSPRY B-box and SPRY domain containing [ Homo sapiens ] |
Official Symbol | BSPRY |
Synonyms | BSPRY; B-box and SPRY domain containing; B box and SPRY domain-containing protein; FLJ20150; zetin 1; B-box and SPRY-domain containing protein; |
Gene ID | 54836 |
mRNA Refseq | NM_017688 |
Protein Refseq | NP_060158 |
UniProt ID | Q5W0U4 |
◆ Recombinant Proteins | ||
BSPRY-6632H | Recombinant Human BSPRY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BSPRY-2673H | Recombinant Human BSPRY protein, His-tagged | +Inquiry |
BSPRY-362H | Recombinant Human BSPRY Protein, GST-tagged | +Inquiry |
BSPRY-3744HF | Recombinant Full Length Human BSPRY Protein, GST-tagged | +Inquiry |
BSPRY-2837H | Recombinant Human BSPRY Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSPRY-187HCL | Recombinant Human BSPRY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSPRY Products
Required fields are marked with *
My Review for All BSPRY Products
Required fields are marked with *