Recombinant Human BSPRY protein, His-tagged
Cat.No. : | BSPRY-2673H |
Product Overview : | Recombinant Human BSPRY protein(1-193 aa), fused to His tag, was expressed in E. coli. |
Availability | May 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-193 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BSPRY B-box and SPRY domain containing [ Homo sapiens ] |
Official Symbol | BSPRY |
Synonyms | BSPRY; B-box and SPRY domain containing; B box and SPRY domain-containing protein; FLJ20150; zetin 1; B-box and SPRY-domain containing protein; |
Gene ID | 54836 |
mRNA Refseq | NM_017688 |
Protein Refseq | NP_060158 |
UniProt ID | Q5W0U4 |
◆ Recombinant Proteins | ||
BSPRY-3744HF | Recombinant Full Length Human BSPRY Protein, GST-tagged | +Inquiry |
Bspry-1896M | Recombinant Mouse Bspry Protein, Myc/DDK-tagged | +Inquiry |
BSPRY-6632H | Recombinant Human BSPRY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BSPRY-362H | Recombinant Human BSPRY Protein, GST-tagged | +Inquiry |
BSPRY-2837H | Recombinant Human BSPRY Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSPRY-187HCL | Recombinant Human BSPRY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BSPRY Products
Required fields are marked with *
My Review for All BSPRY Products
Required fields are marked with *
0
Inquiry Basket