Recombinant Human BST2 Protein, His-tagged

Cat.No. : BST2-136H
Product Overview : Recombinant Human BST2 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : BST2 (CD317, Tetherin, HM1.24) is a type II transmembrane glycoprotein functioning as a major mediator of the innate immune defense against the dissemination of enveloped viruses by tethering viron on cell surface. BST2 has a N-terminal cytoplasmic tail for entocytosis and cytoskelatal signaling, a transmembrane domain, an extracellular domain containing putative disulfide bonds and coiled coil region for forming homodimer, and a C-terminal GPI domain for membran anchoring. Both the transmembrane domain and the GPI domain can insert either to the cell membrane or the viral envelope membrane and hold them together to prevent viral release. Virus counteracts BST2 by encoding viral protein as antagonist. These viral proteins interact directly with BST2 to either enhance BST2 endocytosis/lysosomal degradation (such as Vpu) or prevent BST2 secretion pathway by sequestering the protein in endosome. BST2 is overexpressed in gastrointestinal cancers, breast cancer, lung cancer and multiple myeloma. BST2 monoclonal antibody targeting myeloma or lung cancer cells induces celllular cytotoxicity and cell death (ADCC, antibody-dependent cell-mediated cytotoxicity). Thus BST2 serves as a potential target for tumor immunotherapy.
Molecular Mass : ~16 kDa
AA Sequence : MNSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name BST2 bone marrow stromal cell antigen 2 [ Homo sapiens (human) ]
Official Symbol BST2
Synonyms BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin; BST-2; NPC-A-7; HM1.24 antigen; TETHERIN;
Gene ID 684
mRNA Refseq NM_004335
Protein Refseq NP_004326
MIM 600534
UniProt ID Q10589

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BST2 Products

Required fields are marked with *

My Review for All BST2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon