Recombinant Human BTD protein(322-397aa), His-GST&Myc-tagged
Cat.No. : | BTD-5322H |
Product Overview : | Recombinant Human BTD protein(P43251)(322-397aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 322-397aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSE |
Gene Name | BTD biotinidase [ Homo sapiens ] |
Official Symbol | BTD |
Synonyms | BTD; biotinidase; biotinase; |
Gene ID | 686 |
mRNA Refseq | NM_000060 |
Protein Refseq | NP_000051 |
MIM | 609019 |
UniProt ID | P43251 |
◆ Recombinant Proteins | ||
BTD-8393H | Recombinant Human BTD, MYC/DDK-tagged | +Inquiry |
BTD-1110M | Recombinant Mouse BTD Protein, His (Fc)-Avi-tagged | +Inquiry |
BTD-5322H | Recombinant Human BTD protein(322-397aa), His-GST&Myc-tagged | +Inquiry |
Btd-1900M | Recombinant Mouse Btd Protein, Myc/DDK-tagged | +Inquiry |
BTD-2528M | Recombinant Mouse BTD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTD-8395HCL | Recombinant Human BTD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTD Products
Required fields are marked with *
My Review for All BTD Products
Required fields are marked with *
0
Inquiry Basket