Recombinant Human BTG1 Protein, GST-tagged
Cat.No. : | BTG1-382H |
Product Overview : | Human BTG1 full-length ORF ( AAH16759, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.55 kDa |
AA Sequence : | MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTG1 B-cell translocation gene 1, anti-proliferative [ Homo sapiens ] |
Official Symbol | BTG1 |
Synonyms | BTG1; B-cell translocation gene 1, anti-proliferative; protein BTG1; B-cell translocation gene 1 protein; |
Gene ID | 694 |
mRNA Refseq | NM_001731 |
Protein Refseq | NP_001722 |
MIM | 109580 |
UniProt ID | P62324 |
◆ Recombinant Proteins | ||
BTG1-2531M | Recombinant Mouse BTG1 Protein | +Inquiry |
BTG1-1029R | Recombinant Rat BTG1 Protein | +Inquiry |
BTG1-6902C | Recombinant Chicken BTG1 | +Inquiry |
BTG1-1669HF | Recombinant Full Length Human BTG1 Protein, GST-tagged | +Inquiry |
BTG1-067H | Recombinant Human BTG1 Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTG1-8393HCL | Recombinant Human BTG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTG1 Products
Required fields are marked with *
My Review for All BTG1 Products
Required fields are marked with *
0
Inquiry Basket