Recombinant Human BTG1 Protein, GST-tagged
| Cat.No. : | BTG1-382H |
| Product Overview : | Human BTG1 full-length ORF ( AAH16759, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44.55 kDa |
| AA Sequence : | MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BTG1 B-cell translocation gene 1, anti-proliferative [ Homo sapiens ] |
| Official Symbol | BTG1 |
| Synonyms | BTG1; B-cell translocation gene 1, anti-proliferative; protein BTG1; B-cell translocation gene 1 protein; |
| Gene ID | 694 |
| mRNA Refseq | NM_001731 |
| Protein Refseq | NP_001722 |
| MIM | 109580 |
| UniProt ID | P62324 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTG1 Products
Required fields are marked with *
My Review for All BTG1 Products
Required fields are marked with *
