Recombinant Human BTG2 protein, GST-tagged
Cat.No. : | BTG2-10320H |
Product Overview : | Recombinant Human BTG2 protein(1-50 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-50 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | BTG2 BTG family, member 2 [ Homo sapiens ] |
Official Symbol | BTG2 |
Synonyms | BTG2; BTG family, member 2; protein BTG2; B cell translocation gene 2; MGC126063; MGC126064; nerve growth factor inducible anti proliferative; NGF inducible anti proliferative protein PC3; PC3; pheochromacytoma cell 3; TIS21; pheochromacytoma cell-3; B-cell translocation gene 2; NGF-inducible anti-proliferative protein PC3; nerve growth factor-inducible anti-proliferative; |
Gene ID | 7832 |
mRNA Refseq | NM_006763 |
Protein Refseq | NP_006754 |
MIM | 601597 |
UniProt ID | P78543 |
◆ Recombinant Proteins | ||
BTG2-688R | Recombinant Rat BTG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTG2-10320H | Recombinant Human BTG2 protein, GST-tagged | +Inquiry |
BTG2-1030R | Recombinant Rat BTG2 Protein | +Inquiry |
BTG2-1112M | Recombinant Mouse BTG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTG2-383H | Recombinant Human BTG2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTG2-8392HCL | Recombinant Human BTG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTG2 Products
Required fields are marked with *
My Review for All BTG2 Products
Required fields are marked with *