Recombinant Human BTG2 protein, GST-tagged

Cat.No. : BTG2-10320H
Product Overview : Recombinant Human BTG2 protein(1-50 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability December 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-50 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name BTG2 BTG family, member 2 [ Homo sapiens ]
Official Symbol BTG2
Synonyms BTG2; BTG family, member 2; protein BTG2; B cell translocation gene 2; MGC126063; MGC126064; nerve growth factor inducible anti proliferative; NGF inducible anti proliferative protein PC3; PC3; pheochromacytoma cell 3; TIS21; pheochromacytoma cell-3; B-cell translocation gene 2; NGF-inducible anti-proliferative protein PC3; nerve growth factor-inducible anti-proliferative;
Gene ID 7832
mRNA Refseq NM_006763
Protein Refseq NP_006754
MIM 601597
UniProt ID P78543

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTG2 Products

Required fields are marked with *

My Review for All BTG2 Products

Required fields are marked with *

0
cart-icon
0
compare icon