Recombinant Human BTN2A2 Protein (33-262 aa), His-SUMO-tagged
| Cat.No. : | BTN2A2-1093H |
| Product Overview : | Recombinant Human BTN2A2 Protein (33-262 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 33-262 aa |
| Description : | Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | BTN2A2 butyrophilin, subfamily 2, member A2 [ Homo sapiens ] |
| Official Symbol | BTN2A2 |
| Synonyms | BT2A2_HUMAN; BTF2; BTN2A2; butyrophilin 2; |
| Gene ID | 10385 |
| mRNA Refseq | NM_001197237.1 |
| Protein Refseq | NP_001184166.1 |
| MIM | 613591 |
| UniProt ID | Q8WVV5 |
| ◆ Recombinant Proteins | ||
| BTN2A2-1114M | Recombinant Mouse BTN2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL31920MF | Recombinant Full Length Mouse Butyrophilin Subfamily 2 Member A2(Btn2A2) Protein, His-Tagged | +Inquiry |
| BTN2A2-1706M | Recombinant Mouse BTN2A2 protein, His-tagged | +Inquiry |
| BTN2A2-579R | Recombinant Rhesus monkey BTN2A2 Protein, His-tagged | +Inquiry |
| BTN2A2-9591HFL | Recombinant Full Length Human BTN2A2 protein, Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTN2A2-8387HCL | Recombinant Human BTN2A2 293 Cell Lysate | +Inquiry |
| BTN2A2-8388HCL | Recombinant Human BTN2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTN2A2 Products
Required fields are marked with *
My Review for All BTN2A2 Products
Required fields are marked with *
