Recombinant Human BTN2A2 Protein (33-262 aa), His-SUMO-tagged
Cat.No. : | BTN2A2-1093H |
Product Overview : | Recombinant Human BTN2A2 Protein (33-262 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 33-262 aa |
Description : | Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 41.7 kDa |
AA Sequence : | QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | BTN2A2 butyrophilin, subfamily 2, member A2 [ Homo sapiens ] |
Official Symbol | BTN2A2 |
Synonyms | BT2A2_HUMAN; BTF2; BTN2A2; butyrophilin 2; |
Gene ID | 10385 |
mRNA Refseq | NM_001197237.1 |
Protein Refseq | NP_001184166.1 |
MIM | 613591 |
UniProt ID | Q8WVV5 |
◆ Recombinant Proteins | ||
BTN2A2-9591HFL | Recombinant Full Length Human BTN2A2 protein, Flag-tagged | +Inquiry |
BTN2A2-407R | Recombinant Rhesus Macaque BTN2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTN2A2-10327H | Recombinant Human BTN2A2, GST-tagged | +Inquiry |
BTN2A2-258H | Recombinant Human BTN2A2 protein, MYC/DDK-tagged | +Inquiry |
BTN2A2-2180H | Recombinant Human BTN2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN2A2-8388HCL | Recombinant Human BTN2A2 293 Cell Lysate | +Inquiry |
BTN2A2-8387HCL | Recombinant Human BTN2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTN2A2 Products
Required fields are marked with *
My Review for All BTN2A2 Products
Required fields are marked with *
0
Inquiry Basket