Recombinant Human BTNL2 protein, hFc-tagged
Cat.No. : | BTNL2-4538H |
Product Overview : | Recombinant Human BTNL2 protein(Q9UIR0)(24-457 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 24-457 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 75.9 kDa |
AASequence : | KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | BTNL2 butyrophilin-like 2 (MHC class II associated) [ Homo sapiens ] |
Official Symbol | BTNL2 |
Synonyms | SS2; BTL-II; HSBLMHC1 |
Gene ID | 56244 |
mRNA Refseq | NM_019602.1 |
Protein Refseq | NP_062548.1 |
MIM | 606000 |
UniProt ID | Q9UIR0 |
◆ Recombinant Proteins | ||
BTNL2-23H | Recombinant Human BTNL2 Protein, Fc-tagged | +Inquiry |
BTNL2-34H | Recombinant Human BTNL2 Protein, Fc-tagged | +Inquiry |
BTNL2-2033H | Active Recombinant Human BTNL2, MIgG2a Fc-tagged | +Inquiry |
BTNL2-7565H | Recombinant Human BTNL2 protein, hFc-tagged | +Inquiry |
BTNL2-0799H | Recombinant Human BTNL2 Protein (Ser26-Gly454), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTNL2 Products
Required fields are marked with *
My Review for All BTNL2 Products
Required fields are marked with *
0
Inquiry Basket