Recombinant Human BTNL2 protein, hFc-tagged

• Cat.No.: BTNL2-4538H
• Product Overview: Recombinant Human BTNL2 protein(Q9UIR0)(24-457 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 24-457 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 75.9 kDa
• AASequence: KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSES
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: BTNL2 butyrophilin-like 2 (MHC class II associated) [ Homo sapiens ]
• Official Symbol: BTNL2
• Synonyms: SS2; BTL-II; HSBLMHC1
• Gene ID: 56244
• mRNA Refseq: NM_019602.1
• Protein Refseq: NP_062548.1
• MIM: 606000
• UniProt ID: Q9UIR0