Recombinant Human BUB1B

Cat.No. : BUB1B-26124TH
Product Overview : Recombinant fragment of Human BubR1 with a N terminal proprietary tag; predicted molecular weight 39.93 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 130 amino acids
Description : This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer.
Molecular Weight : 39.930kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMST LQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR FLNLWLKLGR
Gene Name BUB1B budding uninhibited by benzimidazoles 1 homolog beta (yeast) [ Homo sapiens ]
Official Symbol BUB1B
Synonyms BUB1B; budding uninhibited; budding uninhibited by benzimidazoles 1 (yeast homolog), beta; mitotic checkpoint serine/threonine-protein kinase BUB1 beta; Bub1A; BUBR1; MAD3L; SSK1;
Gene ID 701
mRNA Refseq NM_001211
Protein Refseq NP_001202
MIM 602860
Uniprot ID O60566
Chromosome Location 15q15
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BUB1B Products

Required fields are marked with *

My Review for All BUB1B Products

Required fields are marked with *

0
cart-icon