Recombinant Human BZW2 Protein, GST-tagged
Cat.No. : | BZW2-411H |
Product Overview : | Human BZW2 full-length ORF ( NP_054757.1, 1 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 74.6 kDa |
AA Sequence : | MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BZW2 basic leucine zipper and W2 domains 2 [ Homo sapiens ] |
Official Symbol | BZW2 |
Synonyms | BZW2; basic leucine zipper and W2 domains 2; basic leucine zipper and W2 domain-containing protein 2; HSPC028; MST017; MSTP017; |
Gene ID | 28969 |
mRNA Refseq | NM_001159767 |
Protein Refseq | NP_001153239 |
UniProt ID | Q9Y6E2 |
◆ Recombinant Proteins | ||
BZW2-1126M | Recombinant Mouse BZW2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BZW2-411R | Recombinant Rhesus Macaque BZW2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BZW2-1502C | Recombinant Chicken BZW2 | +Inquiry |
BZW2-583R | Recombinant Rhesus monkey BZW2 Protein, His-tagged | +Inquiry |
BZW2-10345H | Recombinant Human BZW2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BZW2-8378HCL | Recombinant Human BZW2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BZW2 Products
Required fields are marked with *
My Review for All BZW2 Products
Required fields are marked with *