Recombinant Human C10orf35 Protein, GST-tagged
| Cat.No. : | C10orf35-427H |
| Product Overview : | Human C10orf35 full-length ORF (AAH13587.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 39.71 kDa |
| AA Sequence : | MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf35 chromosome 10 open reading frame 35 [ Homo sapiens ] |
| Official Symbol | C10orf35 |
| Synonyms | C10orf25 |
| Gene ID | 219738 |
| mRNA Refseq | NM_145306.2 |
| Protein Refseq | NP_660349.1 |
| UniProt ID | Q96D05 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf35 Products
Required fields are marked with *
My Review for All C10orf35 Products
Required fields are marked with *
