Recombinant Human C10orf35 Protein, GST-tagged

• Cat.No.: C10orf35-427H
• Product Overview: Human C10orf35 full-length ORF (AAH13587.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.71 kDa
• AA Sequence: MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf35 chromosome 10 open reading frame 35 [ Homo sapiens ]
• Official Symbol: C10orf35
• Synonyms: C10orf25
• Gene ID: 219738
• mRNA Refseq: NM_145306.2
• Protein Refseq: NP_660349.1
• UniProt ID: Q96D05