Recombinant Human C10orf55 Protein, GST-tagged

• Cat.No.: C10orf55-436H
• Product Overview: Human C10orf55 full-length ORF (BAC03908.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 40.37 kDa
• AA Sequence: MELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGIRRTPAP
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf55 chromosome 10 open reading frame 55 [ Homo sapiens ]
• Official Symbol: C10orf55
• Synonyms: bA417O11.3
• Gene ID: 414236
• mRNA Refseq: NM_001001791.2
• Protein Refseq: NP_001001791.2
• UniProt ID: Q5SWW7