Recombinant Human C10orf81 Protein, GST-tagged
| Cat.No. : | C10orf81-446H |
| Product Overview : | Human C10orf81 full-length ORF ( AAH36365, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 56.76 kDa |
| AA Sequence : | MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf81 chromosome 10 open reading frame 81 [ Homo sapiens ] |
| Official Symbol | C10orf81 |
| Synonyms | C10ORF81; chromosome 10 open reading frame 81; PH domain-containing protein C10orf81; bA211N11.2; FLJ23537; epididymis luminal protein 185; HEL185; RP11-211N11.2; |
| Gene ID | 79949 |
| mRNA Refseq | NM_001193434 |
| Protein Refseq | NP_001180363 |
| UniProt ID | Q5SXH7 |
| ◆ Recombinant Proteins | ||
| C10orf81-446H | Recombinant Human C10orf81 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C10orf81-198HCL | Recombinant Human C10orf81 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf81 Products
Required fields are marked with *
My Review for All C10orf81 Products
Required fields are marked with *
