Recombinant Human C10orf81 Protein, GST-tagged

Cat.No. : C10orf81-446H
Product Overview : Human C10orf81 full-length ORF ( AAH36365, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 56.76 kDa
AA Sequence : MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf81 chromosome 10 open reading frame 81 [ Homo sapiens ]
Official Symbol C10orf81
Synonyms C10ORF81; chromosome 10 open reading frame 81; PH domain-containing protein C10orf81; bA211N11.2; FLJ23537; epididymis luminal protein 185; HEL185; RP11-211N11.2;
Gene ID 79949
mRNA Refseq NM_001193434
Protein Refseq NP_001180363
UniProt ID Q5SXH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C10orf81 Products

Required fields are marked with *

My Review for All C10orf81 Products

Required fields are marked with *

0
cart-icon
0
compare icon