Recombinant Human C11orf73 Protein, GST-tagged
| Cat.No. : | C11orf73-484H |
| Product Overview : | Human C11orf73 full-length ORF ( NP_057485.2, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 48 kDa |
| AA Sequence : | MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf73 chromosome 11 open reading frame 73 [ Homo sapiens ] |
| Official Symbol | C11orf73 |
| Synonyms | C11ORF73; chromosome 11 open reading frame 73; uncharacterized protein C11orf73; HSPC138; HSPC179; lethal, Chr 7, Rinchik 6; L7RN6; FLJ43020; |
| Gene ID | 51501 |
| mRNA Refseq | NM_016401 |
| Protein Refseq | NP_057485 |
| UniProt ID | Q53FT3 |
| ◆ Recombinant Proteins | ||
| C11orf73-484H | Recombinant Human C11orf73 Protein, GST-tagged | +Inquiry |
| C11orf73-4501H | Recombinant Human C11orf73 protein, His-SUMO-tagged | +Inquiry |
| C11orf73-10365H | Recombinant Human C11orf73, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C11orf73-8336HCL | Recombinant Human C11orf73 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf73 Products
Required fields are marked with *
My Review for All C11orf73 Products
Required fields are marked with *
