Recombinant Human C11orf73 protein, His-SUMO-tagged

Cat.No. : C11orf73-4501H
Product Overview : Recombinant Human C11orf73 protein(Q53FT3)(1-197aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-197aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.6 kDa
AA Sequence : MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name C11orf73 chromosome 11 open reading frame 73 [ Homo sapiens ]
Official Symbol C11orf73
Synonyms C11ORF73; chromosome 11 open reading frame 73; uncharacterized protein C11orf73; HSPC138; HSPC179; lethal, Chr 7, Rinchik 6; L7RN6; FLJ43020;
Gene ID 51501
mRNA Refseq NM_016401
Protein Refseq NP_057485
UniProt ID Q53FT3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf73 Products

Required fields are marked with *

My Review for All C11orf73 Products

Required fields are marked with *

0
cart-icon