Recombinant Human C12orf39 Protein, GST-tagged

Cat.No. : C12orf39-500H
Product Overview : Human C12orf39 full-length ORF (BAG51298.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.7 kDa
AA Sequence : MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C12orf39 chromosome 12 open reading frame 39 [ Homo sapiens ]
Official Symbol C12orf39
Synonyms C12orf39
Gene ID 80763
mRNA Refseq NM_030572.2
Protein Refseq NP_085049.1
UniProt ID Q9BT56

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C12orf39 Products

Required fields are marked with *

My Review for All C12orf39 Products

Required fields are marked with *

0
cart-icon
0
compare icon