Recombinant Human C12orf39 Protein, GST-tagged
Cat.No. : | C12orf39-500H |
Product Overview : | Human C12orf39 full-length ORF (BAG51298.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C12orf39 chromosome 12 open reading frame 39 [ Homo sapiens ] |
Official Symbol | C12orf39 |
Synonyms | C12orf39 |
Gene ID | 80763 |
mRNA Refseq | NM_030572.2 |
Protein Refseq | NP_085049.1 |
UniProt ID | Q9BT56 |
◆ Recombinant Proteins | ||
C12orf39-500H | Recombinant Human C12orf39 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf39-8321HCL | Recombinant Human C12orf39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12orf39 Products
Required fields are marked with *
My Review for All C12orf39 Products
Required fields are marked with *