Recombinant Human C14ORF166
| Cat.No. : | C14ORF166-26587TH |
| Product Overview : | Recombinant full length Human C14orf166 produced in Saccharomyces cerevisiae; 244 amino acids, MWt 28kDa, tagged with 25 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Tissue specificity : | Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in m |
| Form : | Liquid |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHY KIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQE AIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKN AEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAI RILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGD AVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIAD PKTDHRLGKVGR |
| Sequence Similarities : | Belongs to the UPF0568 family. |
| Full Length : | Full L. |
| Gene Name | C14orf166 chromosome 14 open reading frame 166 [ Homo sapiens ] |
| Official Symbol | C14ORF166 |
| Synonyms | C14ORF166; chromosome 14 open reading frame 166; UPF0568 protein C14orf166; CGI 99; RLL motif containing 1; RLLM1; |
| Gene ID | 51637 |
| mRNA Refseq | NM_016039 |
| Protein Refseq | NP_057123 |
| MIM | 610858 |
| Uniprot ID | Q9Y224 |
| Chromosome Location | 14q22.1 |
| Function | identical protein binding; protein binding; |
| ◆ Recombinant Proteins | ||
| C14ORF166-26586TH | Recombinant Human C14ORF166, His-tagged | +Inquiry |
| C14ORF166-26587TH | Recombinant Human C14ORF166 | +Inquiry |
| C14orf166-11303H | Recombinant Human C14orf166, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C14orf166-8281HCL | Recombinant Human C14orf166 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C14ORF166 Products
Required fields are marked with *
My Review for All C14ORF166 Products
Required fields are marked with *
