Recombinant Human C14ORF166, His-tagged
Cat.No. : | C14ORF166-26586TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-244 of Human C14orf166 with N terminal His tag, 31kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-244 a.a. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in m |
Form : | Lyophilised:Reconstitute with 105 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHY KIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQE AIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKN AEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAI RILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGD AVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIAD PKTDHRLGKVGR |
Sequence Similarities : | Belongs to the UPF0568 family. |
Full Length : | Full L. |
Gene Name | C14orf166 chromosome 14 open reading frame 166 [ Homo sapiens ] |
Official Symbol | C14ORF166 |
Synonyms | C14ORF166; chromosome 14 open reading frame 166; UPF0568 protein C14orf166; CGI 99; RLL motif containing 1; RLLM1; |
Gene ID | 51637 |
mRNA Refseq | NM_016039 |
Protein Refseq | NP_057123 |
MIM | 610858 |
Uniprot ID | Q9Y224 |
Chromosome Location | 14q22.1 |
Function | identical protein binding; protein binding; |
◆ Recombinant Proteins | ||
C14ORF166-26586TH | Recombinant Human C14ORF166, His-tagged | +Inquiry |
C14orf166-11303H | Recombinant Human C14orf166, GST-tagged | +Inquiry |
C14ORF166-26587TH | Recombinant Human C14ORF166 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf166-8281HCL | Recombinant Human C14orf166 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C14ORF166 Products
Required fields are marked with *
My Review for All C14ORF166 Products
Required fields are marked with *