Recombinant Human C15orf65 Protein, GST-tagged

• Cat.No.: C15orf65-4298H
• Product Overview: Human FLJ27352 full-length ORF (1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C15orf65 (Chromosome 15 Open Reading Frame 65) is a Protein Coding gene.
• Molecular Mass: 39.71 kDa
• AA Sequence: MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C15orf65 chromosome 15 open reading frame 65 [ Homo sapiens (human) ]
• Official Symbol: C15orf65
• Synonyms: C15orf65; chromosome 15 open reading frame 65; uncharacterized protein C15orf65
• Gene ID: 145788
• mRNA Refseq: NM_001198784
• Protein Refseq: NP_001185713
• UniProt ID: H3BRN8