Recombinant Human C1orf220 Protein, GST-tagged

• Cat.No.: C1orf220-4315H
• Product Overview: Human FLJ35530 full-length ORF ( NP_997350.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C1orf220 (Chromosome 1 Open Reading Frame 220) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 41.5 kDa
• AA Sequence: MIPVRGLWYCYLQVKKVRLREAERLGPKSQCPAECGAASWISWVLQHQQLLASEWATKDGRGTWGSKPSCMVPALSATSQLLQLGRLNSDLQFVRQRAKKSVSSPSLLQFWCCLSRLSFHALNQKINSTNINIT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C1orf220 chromosome 1 open reading frame 220 [ Homo sapiens (human) ]
• Official Symbol: C1orf220
• Synonyms: C1orf220; chromosome 1 open reading frame 220; FLJ35530; FLJ40199; DKFZp564J047
• Gene ID: 400798
• MIM: 615647
• UniProt ID: Q5T0J3