Recombinant Human C1QL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C1QL3-739H |
Product Overview : | C1QL3 MS Standard C13 and N15-labeled recombinant protein (NP_001010908) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYADTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C1QL3 complement C1q like 3 [ Homo sapiens (human) ] |
Official Symbol | C1QL3 |
Synonyms | C1QL3; complement component 1, q subcomponent-like 3; complement C1q-like protein 3; C1ql; C1QTNF13; CTRP13; K100; |
Gene ID | 389941 |
mRNA Refseq | NM_001010908 |
Protein Refseq | NP_001010908 |
MIM | 615227 |
UniProt ID | Q5VWW1 |
◆ Recombinant Proteins | ||
C1QL3-589R | Recombinant Rhesus monkey C1QL3 Protein, His-tagged | +Inquiry |
C1QL3-739H | Recombinant Human C1QL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C1QL3-52H | Active Recombinant Human C1QL3 protein, Met/His-tagged | +Inquiry |
C1QL3-53H | Recombinant Human C1QL3 protein, MYC/DDK-tagged | +Inquiry |
C1QL3-417R | Recombinant Rhesus Macaque C1QL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QL3 Products
Required fields are marked with *
My Review for All C1QL3 Products
Required fields are marked with *