Recombinant Human C1QL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C1QL3-739H
Product Overview : C1QL3 MS Standard C13 and N15-labeled recombinant protein (NP_001010908) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production.
Molecular Mass : 26.5 kDa
AA Sequence : MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYADTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C1QL3 complement C1q like 3 [ Homo sapiens (human) ]
Official Symbol C1QL3
Synonyms C1QL3; complement component 1, q subcomponent-like 3; complement C1q-like protein 3; C1ql; C1QTNF13; CTRP13; K100;
Gene ID 389941
mRNA Refseq NM_001010908
Protein Refseq NP_001010908
MIM 615227
UniProt ID Q5VWW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QL3 Products

Required fields are marked with *

My Review for All C1QL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon