Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C1QTNF3-3322H
Product Overview : C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C1QTNF3 (C1q And TNF Related 3) is a Protein Coding gene. Diseases associated with C1QTNF3 include Pyosalpinx and Bleeding Disorder, Platelet-Type, 14. An important paralog of this gene is C1QTNF3-AMACR.
Molecular Mass : 35 kDa
AA Sequence : MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens (human) ]
Official Symbol C1QTNF3
Synonyms C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576;
Gene ID 114899
mRNA Refseq NM_181435
Protein Refseq NP_852100
MIM 612045
UniProt ID Q9BXJ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QTNF3 Products

Required fields are marked with *

My Review for All C1QTNF3 Products

Required fields are marked with *

0
cart-icon