Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C1QTNF3-3322H |
| Product Overview : | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | C1QTNF3 (C1q And TNF Related 3) is a Protein Coding gene. Diseases associated with C1QTNF3 include Pyosalpinx and Bleeding Disorder, Platelet-Type, 14. An important paralog of this gene is C1QTNF3-AMACR. |
| Molecular Mass : | 35 kDa |
| AA Sequence : | MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens (human) ] |
| Official Symbol | C1QTNF3 |
| Synonyms | C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576; |
| Gene ID | 114899 |
| mRNA Refseq | NM_181435 |
| Protein Refseq | NP_852100 |
| MIM | 612045 |
| UniProt ID | Q9BXJ4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *



