Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1QTNF3-3322H
• Product Overview: C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C1QTNF3 (C1q And TNF Related 3) is a Protein Coding gene. Diseases associated with C1QTNF3 include Pyosalpinx and Bleeding Disorder, Platelet-Type, 14. An important paralog of this gene is C1QTNF3-AMACR.
• Molecular Mass: 35 kDa
• AA Sequence: MLWRQLIYWQLLALFFLPFCLCQDEYMEVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQSPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens (human) ]
• Official Symbol: C1QTNF3
• Synonyms: C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576
• Gene ID: 114899
• mRNA Refseq: NM_181435
• Protein Refseq: NP_852100
• MIM: 612045
• UniProt ID: Q9BXJ4