Recombinant Human C1QTNF9, His-tagged

Cat.No. : C1QTNF9-26127TH
Product Overview : Recombinant fragment from the globular domain of Human C1QTNF9 corresponding to amino acids 195-333 (139 aas) with a N terminal His-tag; predicted MWt: 16 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 139 amino acids
Description : Adiponectin is a major insulin-sensitizing, multimeric hormone derived from adipose tissue that acts on muscle and liver to regulate whole-body glucose and lipid metabolism.
Conjugation : HIS
Molecular Weight : 16.000kDa inclusive of tags
Tissue specificity : Expressed predominantly in adipose tissue.
Form : Lyophilised:Reconstitute in an appropriate buffer.
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS, 55mM Tris HCl, 150mM Sodium chloride, 1mM DTT, pH 8.2
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : ETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
Sequence Similarities : Contains 1 C1q domain.Contains 3 collagen-like domains.
Gene Name C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
Official Symbol C1QTNF9
Synonyms C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915;
Gene ID 338872
mRNA Refseq NM_178540
Protein Refseq NP_848635
MIM 614285
Uniprot ID P0C862
Chromosome Location 13q12.12
Function hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QTNF9 Products

Required fields are marked with *

My Review for All C1QTNF9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon