Recombinant Human C1QTNF9, His-tagged
| Cat.No. : | C1QTNF9-26127TH |
| Product Overview : | Recombinant fragment from the globular domain of Human C1QTNF9 corresponding to amino acids 195-333 (139 aas) with a N terminal His-tag; predicted MWt: 16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 139 amino acids |
| Description : | Adiponectin is a major insulin-sensitizing, multimeric hormone derived from adipose tissue that acts on muscle and liver to regulate whole-body glucose and lipid metabolism. |
| Conjugation : | HIS |
| Molecular Weight : | 16.000kDa inclusive of tags |
| Tissue specificity : | Expressed predominantly in adipose tissue. |
| Form : | Lyophilised:Reconstitute in an appropriate buffer. |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: PBS, 55mM Tris HCl, 150mM Sodium chloride, 1mM DTT, pH 8.2 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP |
| Sequence Similarities : | Contains 1 C1q domain.Contains 3 collagen-like domains. |
| Gene Name | C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ] |
| Official Symbol | C1QTNF9 |
| Synonyms | C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; |
| Gene ID | 338872 |
| mRNA Refseq | NM_178540 |
| Protein Refseq | NP_848635 |
| MIM | 614285 |
| Uniprot ID | P0C862 |
| Chromosome Location | 13q12.12 |
| Function | hormone activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *
