Recombinant Human C1QTNF9, His-tagged
Cat.No. : | C1QTNF9-26127TH |
Product Overview : | Recombinant fragment from the globular domain of Human C1QTNF9 corresponding to amino acids 195-333 (139 aas) with a N terminal His-tag; predicted MWt: 16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 139 amino acids |
Description : | Adiponectin is a major insulin-sensitizing, multimeric hormone derived from adipose tissue that acts on muscle and liver to regulate whole-body glucose and lipid metabolism. |
Conjugation : | HIS |
Molecular Weight : | 16.000kDa inclusive of tags |
Tissue specificity : | Expressed predominantly in adipose tissue. |
Form : | Lyophilised:Reconstitute in an appropriate buffer. |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS, 55mM Tris HCl, 150mM Sodium chloride, 1mM DTT, pH 8.2 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP |
Sequence Similarities : | Contains 1 C1q domain.Contains 3 collagen-like domains. |
Gene Name | C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ] |
Official Symbol | C1QTNF9 |
Synonyms | C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; |
Gene ID | 338872 |
mRNA Refseq | NM_178540 |
Protein Refseq | NP_848635 |
MIM | 614285 |
Uniprot ID | P0C862 |
Chromosome Location | 13q12.12 |
Function | hormone activity; |
◆ Recombinant Proteins | ||
C1qtnf9-2109M | Recombinant Mouse C1qtnf9, His-tagged | +Inquiry |
C1QTNF9-2574M | Recombinant Mouse C1QTNF9 Protein | +Inquiry |
C1QTNF9-0020H | Recombinant Human C1QTNF9 Protein (Gln20-Pro333), C-His-tagged | +Inquiry |
C1QTNF9-2569H | Recombinant Human C1QTNF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QTNF9-5291H | Recombinant Human C1QTNF9 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C1QTNF9-001H | Recombinant Human C1QTNF9 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF9-8134HCL | Recombinant Human C1QTNF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *