Recombinant Human C1QTNF9, His-tagged

• Cat.No.: C1QTNF9-26127TH
• Product Overview: Recombinant fragment from the globular domain of Human C1QTNF9 corresponding to amino acids 195-333 (139 aas) with a N terminal His-tag; predicted MWt: 16 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 139 amino acids
• Description: Adiponectin is a major insulin-sensitizing, multimeric hormone derived from adipose tissue that acts on muscle and liver to regulate whole-body glucose and lipid metabolism.
• Conjugation: HIS
• Molecular Weight: 16.000kDa inclusive of tags
• Tissue specificity: Expressed predominantly in adipose tissue.
• Form: Lyophilised:Reconstitute in an appropriate buffer.
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: PBS, 55mM Tris HCl, 150mM Sodium chloride, 1mM DTT, pH 8.2
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: ETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
• Sequence Similarities: Contains 1 C1q domain.Contains 3 collagen-like domains.

Gene Information

• Gene Name: C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
• Official Symbol: C1QTNF9
• Synonyms: C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915
• Gene ID: 338872
• mRNA Refseq: NM_178540
• Protein Refseq: NP_848635
• MIM: 614285
• Uniprot ID: P0C862
• Chromosome Location: 13q12.12
• Function: hormone activity