Recombinant Human C1QTNF9 Protein, GST-tagged

Cat.No. : C1QTNF9-5291H
Product Overview : Human MGC48915 full-length ORF ( AAH40438.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C1QTNF9 (C1q And TNF Related 9) is a Protein Coding gene. GO annotations related to this gene include hormone activity. An important paralog of this gene is C1QTNF9B.
Molecular Mass : 61 kDa
AA Sequence : MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
Official Symbol C1QTNF9
Synonyms C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9;
Gene ID 338872
mRNA Refseq NM_178540
Protein Refseq NP_848635
MIM 614285
UniProt ID P0C862

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QTNF9 Products

Required fields are marked with *

My Review for All C1QTNF9 Products

Required fields are marked with *

0
cart-icon
0
compare icon