Recombinant Human C1QTNF9 Protein, GST-tagged
Cat.No. : | C1QTNF9-5291H |
Product Overview : | Human MGC48915 full-length ORF ( AAH40438.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C1QTNF9 (C1q And TNF Related 9) is a Protein Coding gene. GO annotations related to this gene include hormone activity. An important paralog of this gene is C1QTNF9B. |
Molecular Mass : | 61 kDa |
AA Sequence : | MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ] |
Official Symbol | C1QTNF9 |
Synonyms | C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9; |
Gene ID | 338872 |
mRNA Refseq | NM_178540 |
Protein Refseq | NP_848635 |
MIM | 614285 |
UniProt ID | P0C862 |
◆ Recombinant Proteins | ||
C1QTNF9-5291H | Recombinant Human C1QTNF9 Protein, GST-tagged | +Inquiry |
C1QTNF9-238H | Recombinant Human C1QTNF9, His-tagged | +Inquiry |
C1qtnf9-2109M | Recombinant Mouse C1qtnf9, His-tagged | +Inquiry |
C1QTNF9-2574M | Recombinant Mouse C1QTNF9 Protein | +Inquiry |
C1QTNF9-1139M | Recombinant Mouse C1QTNF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF9-8134HCL | Recombinant Human C1QTNF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *
0
Inquiry Basket