Recombinant Human C1QTNF9 Protein, His tagged

Cat.No. : C1QTNF9-001H
Product Overview : Recombinant Human C1QTNF9 Protein with His tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293T
Tag : His
Protein Length : 16-333 aa
Description : Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to be located in extracellular region. Predicted to be part of collagen trimer.
AASequence : NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPHHHHHHHH
Molecular Mass : 34 kDa
Endotoxin : < 1 EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.5 mg/mL by BCA
Gene ID 338872
Gene Name C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ]
Official Symbol 338872
Synonyms C1QTNF9; C1q and TNF related 9; AQL1; CTRP9; C1QTNF9A; complement C1q and tumor necrosis factor-related protein 9A; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A
mRNA Refseq NM_178540
Official Symbol 2 C1QTNF9
Gene ID 2 338872
Gene Name 2 C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ]
mRNA Refseq 2 NM_178540
Protein Refseq 2 NP_848635
MIM 2 614285
UniProt ID 2 P0C862

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QTNF9 Products

Required fields are marked with *

My Review for All C1QTNF9 Products

Required fields are marked with *

0
cart-icon
0
compare icon