Recombinant Human C1QTNF9 Protein, His tagged
Cat.No. : | C1QTNF9-001H |
Product Overview : | Recombinant Human C1QTNF9 Protein with His tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293T |
Tag : | His |
Protein Length : | 16-333 aa |
Description : | Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to be located in extracellular region. Predicted to be part of collagen trimer. |
AASequence : | NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPHHHHHHHH |
Molecular Mass : | 34 kDa |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.5 mg/mL by BCA |
Gene ID | 338872 |
Gene Name | C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ] |
Official Symbol | 338872 |
Synonyms | C1QTNF9; C1q and TNF related 9; AQL1; CTRP9; C1QTNF9A; complement C1q and tumor necrosis factor-related protein 9A; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A |
mRNA Refseq | NM_178540 |
Official Symbol 2 | C1QTNF9 |
Gene ID 2 | 338872 |
Gene Name 2 | C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ] |
mRNA Refseq 2 | NM_178540 |
Protein Refseq 2 | NP_848635 |
MIM 2 | 614285 |
UniProt ID 2 | P0C862 |
◆ Recombinant Proteins | ||
C1QTNF9-1139M | Recombinant Mouse C1QTNF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QTNF9-2574M | Recombinant Mouse C1QTNF9 Protein | +Inquiry |
C1QTNF9-6426HF | Recombinant Full Length Human C1QTNF9 Protein, GST-tagged | +Inquiry |
C1QTNF9-10486H | Recombinant Human C1QTNF9, GST-tagged | +Inquiry |
C1QTNF9-19H | Recombinant Human C1QTNF9 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C1QTNF9-001H | Recombinant Human C1QTNF9 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF9-8134HCL | Recombinant Human C1QTNF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *