Recombinant Human C1QTNF9 Protein, His tagged
| Cat.No. : | C1QTNF9-001H |
| Product Overview : | Recombinant Human C1QTNF9 Protein with His tag was expressed in HEK293T. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293T |
| Tag : | His |
| Protein Length : | 16-333 aa |
| Description : | Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to be located in extracellular region. Predicted to be part of collagen trimer. |
| AASequence : | NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPHHHHHHHH |
| Molecular Mass : | 34 kDa |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.5 mg/mL by BCA |
| Gene ID | 338872 |
| Gene Name | C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ] |
| Official Symbol | 338872 |
| Synonyms | C1QTNF9; C1q and TNF related 9; AQL1; CTRP9; C1QTNF9A; complement C1q and tumor necrosis factor-related protein 9A; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A |
| mRNA Refseq | NM_178540 |
| Official Symbol 2 | C1QTNF9 |
| Gene ID 2 | 338872 |
| Gene Name 2 | C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ] |
| mRNA Refseq 2 | NM_178540 |
| Protein Refseq 2 | NP_848635 |
| MIM 2 | 614285 |
| UniProt ID 2 | P0C862 |
| ◆ Recombinant Proteins | ||
| C1QTNF9-0020H | Recombinant Human C1QTNF9 Protein (Gln20-Pro333), C-His-tagged | +Inquiry |
| C1QTNF9-238H | Recombinant Human C1QTNF9, His-tagged | +Inquiry |
| C1QTNF9-6417Z | Recombinant Zebrafish C1QTNF9 | +Inquiry |
| C1QTNF9-1139M | Recombinant Mouse C1QTNF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| C1qtnf9-2109M | Recombinant Mouse C1qtnf9, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QTNF9-8134HCL | Recombinant Human C1QTNF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *
