Recombinant Human C1QTNF9 Protein, His tagged

• Cat.No.: C1QTNF9-001H
• Product Overview: Recombinant Human C1QTNF9 Protein with His tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: His
• Protein Length: 16-333 aa
• Description: Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to be located in extracellular region. Predicted to be part of collagen trimer.
• AASequence: NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPHHHHHHHH
• Molecular Mass: 34 kDa
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.5 mg/mL by BCA

Gene Information

• Gene Name 2: C1QTNF9 C1q and TNF related 9 [ Homo sapiens (human) ]
• Official Symbol 2: C1QTNF9
• Synonyms 2: C1QTNF9; C1q and TNF related 9; AQL1; CTRP9; C1QTNF9A; complement C1q and tumor necrosis factor-related protein 9A; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A
• Gene ID 2: 338872
• mRNA Refseq 2: NM_178540
• Protein Refseq 2: NP_848635
• MIM 2: 614285
• UniProt ID 2: P0C862