Recombinant Human C20orf203 Protein, GST-tagged
Cat.No. : | C20orf203-4311H |
Product Overview : | Human FLJ33706 full-length ORF (BAC03569.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is thought to be a human-specific protein. Currently available evidence suggests that orthologous regions in other organisms contain sequence differences that would not support production of a protein product. Genome-wide association studies have suggested the possibility that a SNP in the 3' UTR, rs17123507, could be associated with nicotine addiction. Expression of this gene may be elevated in some individuals with Alzheimer's disease. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 47.74 kDa |
AA Sequence : | MFPRPVLNSRAQAILLPQPPNMLDHRQWPPRLASFPFTKTGMLSRATSVLAGLTAHLWDLGGGAGRRTSKAQRVHPQPSHQRQPPPPQHPGPYQERIWVGGEGWGEVGGLRLSKVGRRDREVRRGLRAPAGRGRAMGGMPRMGTVGDFGQALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSRSLFN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C20orf203 chromosome 20 open reading frame 203 [ Homo sapiens (human) ] |
Official Symbol | C20orf203 |
Synonyms | C20orf203; chromosome 20 open reading frame 203; uncharacterized protein C20orf203; alugen |
Gene ID | 284805 |
mRNA Refseq | NM_182584 |
Protein Refseq | NP_872390 |
UniProt ID | Q8NBC4 |
◆ Recombinant Proteins | ||
C20orf203-5017HF | Recombinant Full Length Human C20orf203 Protein, GST-tagged | +Inquiry |
C20orf203-4311H | Recombinant Human C20orf203 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C20orf203 Products
Required fields are marked with *
My Review for All C20orf203 Products
Required fields are marked with *