Recombinant Human C21ORF33 Protein (43-268 aa), GST-tagged

• Cat.No.: C21ORF33-1185H
• Product Overview: Recombinant Human C21ORF33 Protein (43-268 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 43-268 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 50.9 kDa
• AA Sequence: ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ]
• Official Symbol: C21ORF33
• Synonyms: C21ORF33; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI
• Gene ID: 8209
• mRNA Refseq: NM_004649
• Protein Refseq: NP_004640
• MIM: 601659
• UniProt ID: P30042