Recombinant Human C21ORF33 Protein (43-268 aa), GST-tagged
Cat.No. : | C21ORF33-1185H |
Product Overview : | Recombinant Human C21ORF33 Protein (43-268 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 43-268 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 50.9 kDa |
AA Sequence : | ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ] |
Official Symbol | C21ORF33 |
Synonyms | C21ORF33; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI; |
Gene ID | 8209 |
mRNA Refseq | NM_004649 |
Protein Refseq | NP_004640 |
MIM | 601659 |
UniProt ID | P30042 |
◆ Recombinant Proteins | ||
C21orf33-21H | Recombinant Human C21orf33 protein, GST-tagged | +Inquiry |
C21orf33-20H | Recombinant Human C21orf33 protein, GST-tagged | +Inquiry |
C21ORF33-1185H | Recombinant Human C21ORF33 Protein (43-268 aa), GST-tagged | +Inquiry |
C21orf33-713HF | Recombinant Full Length Human C21orf33 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf33-8103HCL | Recombinant Human C21orf33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C21ORF33 Products
Required fields are marked with *
My Review for All C21ORF33 Products
Required fields are marked with *