Recombinant Human C21ORF33 Protein (43-268 aa), GST-tagged

Cat.No. : C21ORF33-1185H
Product Overview : Recombinant Human C21ORF33 Protein (43-268 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 43-268 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 50.9 kDa
AA Sequence : ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name C21orf33 chromosome 21 open reading frame 33 [ Homo sapiens ]
Official Symbol C21ORF33
Synonyms C21ORF33; D21S2048E; ES1; GT335; HES1; KNP I; KNP Ia; KNPH; KNPI;
Gene ID 8209
mRNA Refseq NM_004649
Protein Refseq NP_004640
MIM 601659
UniProt ID P30042

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C21ORF33 Products

Required fields are marked with *

My Review for All C21ORF33 Products

Required fields are marked with *

0
cart-icon